Lineage for d1nktb2 (1nkt B:616-835)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650619Fold a.172: Helical scaffold and wing domains of SecA [81885] (1 superfamily)
    multihelical; consists of 2 all-alpha subdomains
  4. 650620Superfamily a.172.1: Helical scaffold and wing domains of SecA [81886] (1 family) (S)
  5. 650621Family a.172.1.1: Helical scaffold and wing domains of SecA [81887] (1 protein)
  6. 650622Protein Helical scaffold and wing domains of SecA [81888] (2 species)
  7. 650628Species Mycobacterium tuberculosis [TaxId:1773] [89122] (2 PDB entries)
  8. 650630Domain d1nktb2: 1nkt B:616-835 [85835]
    Other proteins in same PDB: d1nkta1, d1nkta3, d1nkta4, d1nktb1, d1nktb3, d1nktb4
    complexed with adp, mg

Details for d1nktb2

PDB Entry: 1nkt (more details), 2.6 Å

PDB Description: crystal structure of the seca protein translocation atpase from mycobacterium tuberculosis complex with adpbs
PDB Compounds: (B:) Preprotein translocase secA 1 subunit

SCOP Domain Sequences for d1nktb2:

Sequence, based on SEQRES records: (download)

>d1nktb2 a.172.1.1 (B:616-835) Helical scaffold and wing domains of SecA {Mycobacterium tuberculosis [TaxId: 1773]}
akmvtraiksaqtqveqqnfevrknvlkydevmnqqrkviyaerrrilegenlkdqaldm
vrdvitayvdgatgegyaedwdldalwtalktlypvgitadsltrkdheferddltreel
leallkdaerayaareaeleeiagegamrqlernvllnvidrkwrehlyemdylkegigl
ramaqrdplveyqregydmfmamldgmkeesvgflfnvtv

Sequence, based on observed residues (ATOM records): (download)

>d1nktb2 a.172.1.1 (B:616-835) Helical scaffold and wing domains of SecA {Mycobacterium tuberculosis [TaxId: 1773]}
akmvtraiksaqtqveqqnfevrknvlkydevmnqqrkviyaerrrilegenlkdqaldm
vrdvitayvdgatgegyaedwdldalwtalktlypvgitadsltlleallkdaerayaar
eaeleeiagegamrqlernvllnvidrkwrehlyemdylkegiglramaqrdplveyqre
gydmfmamldgmkeesvgflfnvtv

SCOP Domain Coordinates for d1nktb2:

Click to download the PDB-style file with coordinates for d1nktb2.
(The format of our PDB-style files is described here.)

Timeline for d1nktb2: