Lineage for d1nktb2 (1nkt B:616-835)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014124Fold a.172: Helical scaffold and wing domains of SecA [81885] (1 superfamily)
    multihelical; consists of 2 all-alpha subdomains
  4. 2014125Superfamily a.172.1: Helical scaffold and wing domains of SecA [81886] (1 family) (S)
    automatically mapped to Pfam PF07516
  5. 2014126Family a.172.1.1: Helical scaffold and wing domains of SecA [81887] (1 protein)
  6. 2014127Protein Helical scaffold and wing domains of SecA [81888] (3 species)
  7. 2014133Species Mycobacterium tuberculosis [TaxId:1773] [89122] (2 PDB entries)
  8. 2014135Domain d1nktb2: 1nkt B:616-835 [85835]
    Other proteins in same PDB: d1nkta1, d1nkta3, d1nkta4, d1nkta5, d1nktb1, d1nktb3, d1nktb4, d1nktb5
    complexed with adp, mg

Details for d1nktb2

PDB Entry: 1nkt (more details), 2.6 Å

PDB Description: crystal structure of the seca protein translocation atpase from mycobacterium tuberculosis complex with adpbs
PDB Compounds: (B:) Preprotein translocase secA 1 subunit

SCOPe Domain Sequences for d1nktb2:

Sequence, based on SEQRES records: (download)

>d1nktb2 a.172.1.1 (B:616-835) Helical scaffold and wing domains of SecA {Mycobacterium tuberculosis [TaxId: 1773]}
akmvtraiksaqtqveqqnfevrknvlkydevmnqqrkviyaerrrilegenlkdqaldm
vrdvitayvdgatgegyaedwdldalwtalktlypvgitadsltrkdheferddltreel
leallkdaerayaareaeleeiagegamrqlernvllnvidrkwrehlyemdylkegigl
ramaqrdplveyqregydmfmamldgmkeesvgflfnvtv

Sequence, based on observed residues (ATOM records): (download)

>d1nktb2 a.172.1.1 (B:616-835) Helical scaffold and wing domains of SecA {Mycobacterium tuberculosis [TaxId: 1773]}
akmvtraiksaqtqveqqnfevrknvlkydevmnqqrkviyaerrrilegenlkdqaldm
vrdvitayvdgatgegyaedwdldalwtalktlypvgitadsltlleallkdaerayaar
eaeleeiagegamrqlernvllnvidrkwrehlyemdylkegiglramaqrdplveyqre
gydmfmamldgmkeesvgflfnvtv

SCOPe Domain Coordinates for d1nktb2:

Click to download the PDB-style file with coordinates for d1nktb2.
(The format of our PDB-style files is described here.)

Timeline for d1nktb2: