SCOP 1.75: Domain d1nktb1: 1nkt B:226-349

Lineage for d1nktb1 (1nkt B:226-349)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.162: Pre-protein crosslinking domain of SecA [81766] (1 superfamily)
   core: 4 helices: bundle; flanked by two short beta-hairpins
   duplication: consists of two structural repeats

4. Superfamily a.162.1: Pre-protein crosslinking domain of SecA [81767] (1 family)

5. Family a.162.1.1: Pre-protein crosslinking domain of SecA [81768] (1 protein)

6. Protein Pre-protein crosslinking domain of SecA [81769] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [89058] (2 PDB entries)

8. Domain d1nktb1: 1nkt B:226-349 [85834]
   Other proteins in same PDB: d1nkta2, d1nkta3, d1nkta4, d1nktb2, d1nktb3, d1nktb4
   complexed with adp, mg

Details for d1nktb1

PDB Entry: 1nkt, 2.6 Å

PDB Description: crystal structure of the seca protein translocation atpase from mycobacterium tuberculosis complex with adpbs

PDB Compounds: (B:) Preprotein translocase secA 1 subunit

SCOP Domain Sequences for d1nktb1:

Sequence; same for both SEQRES and ATOM records:

>d1nktb1 a.162.1.1 (B:226-349) Pre-protein crosslinking domain of SecA {Mycobacterium tuberculosis [TaxId: 1773]}
gpadgasnwytefarlaplmekdvhyevdlrkrtvgvhekgvefvedqlgidnlyeaans
plvsylnnalkakelfsrdkdyivrdgevlivdeftgrvligrrynegmhqaieakehve
ikae

Timeline for d1nktb1:

• d1nktb1 first appeared in SCOP 1.65
  
• d1nktb1 appears in SCOP 1.73
  
• d1nktb1 appears in SCOPe 2.01
  
• d1nktb1 appears in the current release, SCOPe 2.08