![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.162: Pre-protein crosslinking domain of SecA [81766] (1 superfamily) core: 4 helices: bundle; flanked by two short beta-hairpins duplication: consists of two structural repeats |
![]() | Superfamily a.162.1: Pre-protein crosslinking domain of SecA [81767] (1 family) ![]() automatically mapped to Pfam PF01043 |
![]() | Family a.162.1.1: Pre-protein crosslinking domain of SecA [81768] (1 protein) |
![]() | Protein Pre-protein crosslinking domain of SecA [81769] (3 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [89058] (2 PDB entries) |
![]() | Domain d1nktb1: 1nkt B:226-349 [85834] Other proteins in same PDB: d1nkta2, d1nkta3, d1nkta4, d1nkta5, d1nktb2, d1nktb3, d1nktb4, d1nktb5 complexed with adp, mg |
PDB Entry: 1nkt (more details), 2.6 Å
SCOPe Domain Sequences for d1nktb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nktb1 a.162.1.1 (B:226-349) Pre-protein crosslinking domain of SecA {Mycobacterium tuberculosis [TaxId: 1773]} gpadgasnwytefarlaplmekdvhyevdlrkrtvgvhekgvefvedqlgidnlyeaans plvsylnnalkakelfsrdkdyivrdgevlivdeftgrvligrrynegmhqaieakehve ikae
Timeline for d1nktb1: