![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
![]() | Protein Translocation ATPase SecA, nucleotide-binding domains, C-terminal domain [418979] (3 species) |
![]() | Domain d1nkta4: 1nkt A:397-615 [85833] Other proteins in same PDB: d1nkta1, d1nkta2, d1nkta3, d1nkta5, d1nktb1, d1nktb2, d1nktb3, d1nktb5 complexed with adp, mg has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1nkt (more details), 2.6 Å
SCOPe Domain Sequences for d1nkta4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} mpmiredqsdliykteeakyiavvddvaeryakgqpvligttsverseylsrqftkrrip hnvlnakyheqeatiiavagrrggvtvatnmagrgtdivlggnvdfltdqrlrergldpv etpeeyeaawhselpivkeeaskeakevieagglyvlgterhesrridnqlrgrsgrqgd pgesrfylslgdelmrrfngaaletlltrlnlpddvpie
Timeline for d1nkta4: