Lineage for d1nkta1 (1nkt A:226-349)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1752495Fold a.162: Pre-protein crosslinking domain of SecA [81766] (1 superfamily)
    core: 4 helices: bundle; flanked by two short beta-hairpins
    duplication: consists of two structural repeats
  4. 1752496Superfamily a.162.1: Pre-protein crosslinking domain of SecA [81767] (1 family) (S)
    automatically mapped to Pfam PF01043
  5. 1752497Family a.162.1.1: Pre-protein crosslinking domain of SecA [81768] (1 protein)
  6. 1752498Protein Pre-protein crosslinking domain of SecA [81769] (3 species)
  7. 1752504Species Mycobacterium tuberculosis [TaxId:1773] [89058] (2 PDB entries)
  8. 1752505Domain d1nkta1: 1nkt A:226-349 [85830]
    Other proteins in same PDB: d1nkta2, d1nkta3, d1nkta4, d1nktb2, d1nktb3, d1nktb4
    complexed with adp, mg

Details for d1nkta1

PDB Entry: 1nkt (more details), 2.6 Å

PDB Description: crystal structure of the seca protein translocation atpase from mycobacterium tuberculosis complex with adpbs
PDB Compounds: (A:) Preprotein translocase secA 1 subunit

SCOPe Domain Sequences for d1nkta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nkta1 a.162.1.1 (A:226-349) Pre-protein crosslinking domain of SecA {Mycobacterium tuberculosis [TaxId: 1773]}
gpadgasnwytefarlaplmekdvhyevdlrkrtvgvhekgvefvedqlgidnlyeaans
plvsylnnalkakelfsrdkdyivrdgevlivdeftgrvligrrynegmhqaieakehve
ikae

SCOPe Domain Coordinates for d1nkta1:

Click to download the PDB-style file with coordinates for d1nkta1.
(The format of our PDB-style files is described here.)

Timeline for d1nkta1: