SCOP 1.67: Domain d1nknd_: 1nkn D:

Lineage for d1nknd_ (1nkn D:)

1. Root: SCOP 1.67

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.1: Parallel coiled-coil [57943] (27 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.26: Myosin rod fragments [90257] (1 family)

5. Family h.1.26.1: Myosin rod fragments [90258] (1 protein)

6. Protein Myosin S2N51 [90259] (1 species)

7. Species Bay scallop (Argopecten irradians) [TaxId:31199] [90260] (1 PDB entry)

8. Domain d1nknd_: 1nkn D: [85828]
   contains a fragment of the yeast GCN4 leucine zipper

Details for d1nknd_

PDB Entry: 1nkn, 2.5 Å

PDB Description: visualizing an unstable coiled coil: the crystal structure of an n-terminal segment of the scallop myosin rod

SCOP Domain Sequences for d1nknd_:

Sequence; same for both SEQRES and ATOM records:

>d1nknd_ h.1.26.1 (D:) Myosin S2N51 {Bay scallop (Argopecten irradians)}
eeemkeqlkqmdkmkedlakterikkeleeqnvtlleqkndlfgsmkqledkveellskn
yhlenevarlkklvge

Timeline for d1nknd_:

• d1nknd_ first appeared in SCOP 1.65
  
• d1nknd_ appears in SCOP 1.69
  
• d1nknd_ appears in the current release, SCOPe 2.08