Lineage for d1nknd_ (1nkn D:)

  1. Root: SCOP 1.65
  2. 344849Class h: Coiled coil proteins [57942] (6 folds)
  3. 344850Fold h.1: Parallel coiled-coil [57943] (26 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 345549Superfamily h.1.26: Myosin rod fragments [90257] (1 family) (S)
  5. 345550Family h.1.26.1: Myosin rod fragments [90258] (1 protein)
  6. 345551Protein Myosin S2N51 [90259] (1 species)
  7. 345552Species Bay scallop (Argopecten irradians) [TaxId:31199] [90260] (1 PDB entry)
  8. 345556Domain d1nknd_: 1nkn D: [85828]
    contains a fragment of the yeast GCN4 leucine zipper

Details for d1nknd_

PDB Entry: 1nkn (more details), 2.5 Å

PDB Description: visualizing an unstable coiled coil: the crystal structure of an n-terminal segment of the scallop myosin rod

SCOP Domain Sequences for d1nknd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nknd_ h.1.26.1 (D:) Myosin S2N51 {Bay scallop (Argopecten irradians)}
eeemkeqlkqmdkmkedlakterikkeleeqnvtlleqkndlfgsmkqledkveellskn
yhlenevarlkklvge

SCOP Domain Coordinates for d1nknd_:

Click to download the PDB-style file with coordinates for d1nknd_.
(The format of our PDB-style files is described here.)

Timeline for d1nknd_: