Lineage for d1nknc_ (1nkn C:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040541Superfamily h.1.26: Myosin rod fragments [90257] (2 families) (S)
  5. 3040542Family h.1.26.1: Myosin rod fragments [90258] (2 proteins)
  6. 3040551Protein Myosin S2N51 [90259] (1 species)
  7. 3040552Species Bay scallop (Argopecten irradians) [TaxId:31199] [90260] (2 PDB entries)
  8. 3040555Domain d1nknc_: 1nkn C: [85827]
    contains a fragment of the yeast GCN4 leucine zipper

Details for d1nknc_

PDB Entry: 1nkn (more details), 2.5 Å

PDB Description: visualizing an unstable coiled coil: the crystal structure of an n-terminal segment of the scallop myosin rod
PDB Compounds: (C:) s2n51-gcn4

SCOPe Domain Sequences for d1nknc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nknc_ h.1.26.1 (C:) Myosin S2N51 {Bay scallop (Argopecten irradians) [TaxId: 31199]}
emkeqlkqmdkmkedlakterikkeleeqnvtlleqkndlfgsmkqledkveellsknyh
lenevarlkklvger

SCOPe Domain Coordinates for d1nknc_:

Click to download the PDB-style file with coordinates for d1nknc_.
(The format of our PDB-style files is described here.)

Timeline for d1nknc_: