Class h: Coiled coil proteins [57942] (6 folds) |
Fold h.1: Parallel coiled-coil [57943] (26 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.26: Myosin rod fragments [90257] (1 family) |
Family h.1.26.1: Myosin rod fragments [90258] (1 protein) |
Protein Myosin S2N51 [90259] (1 species) |
Species Bay scallop (Argopecten irradians) [TaxId:31199] [90260] (1 PDB entry) |
Domain d1nknb_: 1nkn B: [85826] |
PDB Entry: 1nkn (more details), 2.5 Å
SCOP Domain Sequences for d1nknb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nknb_ h.1.26.1 (B:) Myosin S2N51 {Bay scallop (Argopecten irradians)} eeemkeqlkqmdkmkedlakterikkeleeqnvtlleqkndlfgsmkqledkveellskn yhlenevarlkklvge
Timeline for d1nknb_: