Lineage for d1nknb_ (1nkn B:)

  1. Root: SCOP 1.65
  2. 344849Class h: Coiled coil proteins [57942] (6 folds)
  3. 344850Fold h.1: Parallel coiled-coil [57943] (26 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 345549Superfamily h.1.26: Myosin rod fragments [90257] (1 family) (S)
  5. 345550Family h.1.26.1: Myosin rod fragments [90258] (1 protein)
  6. 345551Protein Myosin S2N51 [90259] (1 species)
  7. 345552Species Bay scallop (Argopecten irradians) [TaxId:31199] [90260] (1 PDB entry)
  8. 345554Domain d1nknb_: 1nkn B: [85826]

Details for d1nknb_

PDB Entry: 1nkn (more details), 2.5 Å

PDB Description: visualizing an unstable coiled coil: the crystal structure of an n-terminal segment of the scallop myosin rod

SCOP Domain Sequences for d1nknb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nknb_ h.1.26.1 (B:) Myosin S2N51 {Bay scallop (Argopecten irradians)}
eeemkeqlkqmdkmkedlakterikkeleeqnvtlleqkndlfgsmkqledkveellskn
yhlenevarlkklvge

SCOP Domain Coordinates for d1nknb_:

Click to download the PDB-style file with coordinates for d1nknb_.
(The format of our PDB-style files is described here.)

Timeline for d1nknb_: