SCOP 1.65: Domain d1njsb_: 1njs B:

Lineage for d1njsb_ (1njs B:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.65: Formyltransferase [53327] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest

4. Superfamily c.65.1: Formyltransferase [53328] (1 family)

5. Family c.65.1.1: Formyltransferase [53329] (2 proteins)

6. Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82468] (4 PDB entries)

8. Domain d1njsb_: 1njs B: [85824]
   complexed with keu, po4

Details for d1njsb_

PDB Entry: 1njs, 1.98 Å

PDB Description: human GAR Tfase in complex with hydrolyzed form of 10-trifluoroacetyl-5,10-dideaza-acyclic-5,6,7,8-tetrahydrofolic acid

SCOP Domain Sequences for d1njsb_:

Sequence; same for both SEQRES and ATOM records:

>d1njsb_ c.65.1.1 (B:) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens)}
arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
lqlvasgtvqlgengkicwv

Timeline for d1njsb_:

• d1njsb_ is new in SCOP 1.65
  
• d1njsb_ appears in SCOP 1.67
  
• d1njsb_ appears in the current release, SCOPe 2.08