Lineage for d1njkd_ (1njk D:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 502577Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 502578Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (6 families) (S)
  5. 502579Family d.38.1.1: 4HBT-like [54638] (4 proteins)
  6. 502586Protein Hypothetical protein YbaW [89900] (1 species)
  7. 502587Species Escherichia coli [TaxId:562] [89901] (1 PDB entry)
  8. 502591Domain d1njkd_: 1njk D: [85821]
    structural genomics

Details for d1njkd_

PDB Entry: 1njk (more details), 1.9 Å

PDB Description: Crystal Structure of YbaW Probable Thioesterase from Escherichia coli

SCOP Domain Sequences for d1njkd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1njkd_ d.38.1.1 (D:) Hypothetical protein YbaW {Escherichia coli}
hmqtqikvrgyhldvyqhvnnarylefleearwdglensdsfqwmtahniafvvvninin
yrrpavlsdlltitsqlqqlngksgilsqvitlepegqvvadalitfvcidlktqkalal
egelrekleqmvk

SCOP Domain Coordinates for d1njkd_:

Click to download the PDB-style file with coordinates for d1njkd_.
(The format of our PDB-style files is described here.)

Timeline for d1njkd_: