SCOPe 2.07: Domain d1njkc1: 1njk C:1-132

Lineage for d1njkc1 (1njk C:1-132)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.1: 4HBT-like [54638] (19 proteins)
   Pfam PF03061

6. Protein Hypothetical protein YbaW [89900] (1 species)

7. Species Escherichia coli [TaxId:562] [89901] (1 PDB entry)

8. Domain d1njkc1: 1njk C:1-132 [85820]
   Other proteins in same PDB: d1njka2, d1njkb2, d1njkc2, d1njkd2
   structural genomics
   complexed with iod

Details for d1njkc1

PDB Entry: 1njk, 1.9 Å

PDB Description: Crystal Structure of YbaW Probable Thioesterase from Escherichia coli

PDB Compounds: (C:) Hypothetical protein ybaW

SCOPe Domain Sequences for d1njkc1:

Sequence; same for both SEQRES and ATOM records:

>d1njkc1 d.38.1.1 (C:1-132) Hypothetical protein YbaW {Escherichia coli [TaxId: 562]}
mqtqikvrgyhldvyqhvnnarylefleearwdglensdsfqwmtahniafvvvnininy
rrpavlsdlltitsqlqqlngksgilsqvitlepegqvvadalitfvcidlktqkalale
gelrekleqmvk

Timeline for d1njkc1:

• d1njkc1 first appeared in SCOP 1.65, called d1njkc_
  
• d1njkc1 appears in SCOPe 2.06
  
• d1njkc1 appears in the current release, SCOPe 2.08