SCOPe 2.03: Domain d1njkc_: 1njk C:

Lineage for d1njkc_ (1njk C:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.1: 4HBT-like [54638] (19 proteins)
   Pfam PF03061

6. Protein Hypothetical protein YbaW [89900] (1 species)

7. Species Escherichia coli [TaxId:562] [89901] (1 PDB entry)

8. Domain d1njkc_: 1njk C: [85820]
   structural genomics
   complexed with iod

Details for d1njkc_

PDB Entry: 1njk, 1.9 Å

PDB Description: Crystal Structure of YbaW Probable Thioesterase from Escherichia coli

PDB Compounds: (C:) Hypothetical protein ybaW

SCOPe Domain Sequences for d1njkc_:

Sequence; same for both SEQRES and ATOM records:

>d1njkc_ d.38.1.1 (C:) Hypothetical protein YbaW {Escherichia coli [TaxId: 562]}
hmqtqikvrgyhldvyqhvnnarylefleearwdglensdsfqwmtahniafvvvninin
yrrpavlsdlltitsqlqqlngksgilsqvitlepegqvvadalitfvcidlktqkalal
egelrekleqmvk

Timeline for d1njkc_:

• d1njkc_ first appeared in SCOP 1.65
  
• d1njkc_ appears in SCOPe 2.02
  
• d1njkc_ appears in SCOPe 2.04
  
• d1njkc_ appears in the current release, SCOPe 2.08, called d1njkc1