Lineage for d1njka1 (1njk A:1-132)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187707Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2187708Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2187709Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 2187760Protein Hypothetical protein YbaW [89900] (1 species)
  7. 2187761Species Escherichia coli [TaxId:562] [89901] (1 PDB entry)
  8. 2187762Domain d1njka1: 1njk A:1-132 [85818]
    Other proteins in same PDB: d1njka2, d1njkb2, d1njkc2, d1njkd2
    structural genomics
    complexed with iod

Details for d1njka1

PDB Entry: 1njk (more details), 1.9 Å

PDB Description: Crystal Structure of YbaW Probable Thioesterase from Escherichia coli
PDB Compounds: (A:) Hypothetical protein ybaW

SCOPe Domain Sequences for d1njka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1njka1 d.38.1.1 (A:1-132) Hypothetical protein YbaW {Escherichia coli [TaxId: 562]}
mqtqikvrgyhldvyqhvnnarylefleearwdglensdsfqwmtahniafvvvnininy
rrpavlsdlltitsqlqqlngksgilsqvitlepegqvvadalitfvcidlktqkalale
gelrekleqmvk

SCOPe Domain Coordinates for d1njka1:

Click to download the PDB-style file with coordinates for d1njka1.
(The format of our PDB-style files is described here.)

Timeline for d1njka1: