Lineage for d1njiz_ (1nji Z:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2111376Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 2111434Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 2111435Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 2111436Protein Ribosomal protein L32e [52044] (1 species)
  7. 2111437Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries)
    Uniprot P12736
  8. 2111462Domain d1njiz_: 1nji Z: [85817]
    Other proteins in same PDB: d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njic1, d1njic2, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njij_, d1njik_, d1njil_, d1njim_, d1njin_, d1njio_, d1njip_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiu_, d1njiv_, d1njiw_, d1njix_, d1njiy_
    complexed with cd, cl, clm, k, mg, na

Details for d1njiz_

PDB Entry: 1nji (more details), 3 Å

PDB Description: Structure of chloramphenicol bound to the 50S ribosomal subunit
PDB Compounds: (Z:) 50S ribosomal protein L32e

SCOPe Domain Sequences for d1njiz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1njiz_ c.9.2.1 (Z:) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOPe Domain Coordinates for d1njiz_:

Click to download the PDB-style file with coordinates for d1njiz_.
(The format of our PDB-style files is described here.)

Timeline for d1njiz_: