Lineage for d1njiy_ (1nji Y:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1200379Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
    beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342
  4. 1200380Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) (S)
  5. 1200381Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)
  6. 1200382Protein Ribosomal protein L31e [54577] (1 species)
  7. 1200383Species Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries)
    Uniprot P18138
  8. 1200406Domain d1njiy_: 1nji Y: [85816]
    Other proteins in same PDB: d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njic1, d1njic2, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njij_, d1njik_, d1njil_, d1njim_, d1njin_, d1njio_, d1njip_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiu_, d1njiv_, d1njiw_, d1njix_, d1njiz_
    complexed with cd, cl, clm, k, mg, na

Details for d1njiy_

PDB Entry: 1nji (more details), 3 Å

PDB Description: Structure of chloramphenicol bound to the 50S ribosomal subunit
PDB Compounds: (Y:) 50S ribosomal protein L31e

SCOPe Domain Sequences for d1njiy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1njiy_ d.29.1.1 (Y:) Ribosomal protein L31e {Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOPe Domain Coordinates for d1njiy_:

Click to download the PDB-style file with coordinates for d1njiy_.
(The format of our PDB-style files is described here.)

Timeline for d1njiy_: