SCOP 1.73: Domain d1njiu_: 1nji U:

Lineage for d1njiu_ (1nji U:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.34: SH3-like barrel [50036] (18 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (6 families)
   many known members contain KOW motif

5. Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)

6. Protein Ribosomal proteins L24 (L24p) [50106] (2 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [50107] (44 PDB entries)

8. Domain d1njiu_: 1nji U: [85812]
   Other proteins in same PDB: d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njic1, d1njic2, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njij_, d1njik_, d1njil_, d1njim_, d1njin_, d1njio_, d1njip_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiv_, d1njiw_, d1njix_, d1njiy_, d1njiz_
   complexed with cd, cl, clm, k, mg, na; mutant

Details for d1njiu_

PDB Entry: 1nji, 3 Å

PDB Description: Structure of chloramphenicol bound to the 50S ribosomal subunit

PDB Compounds: (U:) 50S ribosomal protein L24P

SCOP Domain Sequences for d1njiu_:

Sequence; same for both SEQRES and ATOM records:

>d1njiu_ b.34.5.1 (U:) Ribosomal proteins L24 (L24p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

Timeline for d1njiu_:

• d1njiu_ first appeared in SCOP 1.65
  
• d1njiu_ appears in SCOP 1.71
  
• d1njiu_ appears in SCOP 1.75
  
• d1njiu_ appears in the current release, SCOPe 2.08