![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (13 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families) ![]() many known members contain KOW motif |
![]() | Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins) |
![]() | Protein Ribosomal proteins L24 (L24p) [50106] (1 species) |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [50107] (12 PDB entries) |
![]() | Domain d1njiu_: 1nji U: [85812] Other proteins in same PDB: d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njic1, d1njic2, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njij_, d1njik_, d1njil_, d1njim_, d1njin_, d1njio_, d1njip_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiv_, d1njiw_, d1njix_, d1njiy_, d1njiz_ complexed with cd, cl, clm, k, mg, na; mutant |
PDB Entry: 1nji (more details), 3 Å
SCOP Domain Sequences for d1njiu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1njiu_ b.34.5.1 (U:) Ribosomal proteins L24 (L24p) {Archaeon Haloarcula marismortui} skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa
Timeline for d1njiu_:
![]() Domains from other chains: (mouse over for more information) d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njic1, d1njic2, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njij_, d1njik_, d1njil_, d1njim_, d1njin_, d1njio_, d1njip_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiv_, d1njiw_, d1njix_, d1njiy_, d1njiz_ |