Lineage for d1njiq_ (1nji Q:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 283987Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 283988Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
  5. 283989Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 283990Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 283991Species Archaeon Haloarcula marismortui [TaxId:2238] [48143] (12 PDB entries)
  8. 283995Domain d1njiq_: 1nji Q: [85808]
    Other proteins in same PDB: d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njic1, d1njic2, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njij_, d1njik_, d1njil_, d1njim_, d1njin_, d1njio_, d1njip_, d1njir_, d1njis_, d1njit_, d1njiu_, d1njiv_, d1njiw_, d1njix_, d1njiy_, d1njiz_
    complexed with cd, cl, clm, k, mg, na; mutant

Details for d1njiq_

PDB Entry: 1nji (more details), 3 Å

PDB Description: Structure of chloramphenicol bound to the 50S ribosomal subunit

SCOP Domain Sequences for d1njiq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1njiq_ a.94.1.1 (Q:) Ribosomal protein L19 (L19e) {Archaeon Haloarcula marismortui}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOP Domain Coordinates for d1njiq_:

Click to download the PDB-style file with coordinates for d1njiq_.
(The format of our PDB-style files is described here.)

Timeline for d1njiq_: