Lineage for d1njip_ (1nji P:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1835020Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 1835021Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 1835022Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 1835114Protein Ribosomal protein L18e [52084] (1 species)
  7. 1835115Species Haloarcula marismortui [TaxId:2238] [52085] (40 PDB entries)
    Uniprot P12733
  8. 1835138Domain d1njip_: 1nji P: [85807]
    Other proteins in same PDB: d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njic1, d1njic2, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njij_, d1njik_, d1njil_, d1njim_, d1njin_, d1njio_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiu_, d1njiv_, d1njiw_, d1njix_, d1njiy_, d1njiz_
    complexed with cd, cl, clm, k, mg, na

Details for d1njip_

PDB Entry: 1nji (more details), 3 Å

PDB Description: Structure of chloramphenicol bound to the 50S ribosomal subunit
PDB Compounds: (P:) 50S ribosomal protein L18e

SCOPe Domain Sequences for d1njip_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1njip_ c.12.1.1 (P:) Ribosomal protein L18e {Haloarcula marismortui [TaxId: 2238]}
sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir

SCOPe Domain Coordinates for d1njip_:

Click to download the PDB-style file with coordinates for d1njip_.
(The format of our PDB-style files is described here.)

Timeline for d1njip_: