Lineage for d1njip_ (1nji P:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 310498Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 310499Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 310500Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 310515Protein Ribosomal protein L18e [52084] (1 species)
  7. 310516Species Archaeon Haloarcula marismortui [TaxId:2238] [52085] (12 PDB entries)
  8. 310520Domain d1njip_: 1nji P: [85807]
    Other proteins in same PDB: d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njic1, d1njic2, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njij_, d1njik_, d1njil_, d1njim_, d1njin_, d1njio_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiu_, d1njiv_, d1njiw_, d1njix_, d1njiy_, d1njiz_
    complexed with cd, cl, clm, k, mg, na; mutant

Details for d1njip_

PDB Entry: 1nji (more details), 3 Å

PDB Description: Structure of chloramphenicol bound to the 50S ribosomal subunit

SCOP Domain Sequences for d1njip_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1njip_ c.12.1.1 (P:) Ribosomal protein L18e {Archaeon Haloarcula marismortui}
sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir

SCOP Domain Coordinates for d1njip_:

Click to download the PDB-style file with coordinates for d1njip_.
(The format of our PDB-style files is described here.)

Timeline for d1njip_: