SCOP 1.73: Domain d1njim_: 1nji M:

Lineage for d1njim_ (1nji M:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
   core: three turns of irregular (beta-beta-alpha)n superhelix

4. Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family)

5. Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)

6. Protein Ribosomal protein L15 (L15p) [52082] (2 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [52083] (40 PDB entries)

8. Domain d1njim_: 1nji M: [85804]
   Other proteins in same PDB: d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njic1, d1njic2, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njij_, d1njik_, d1njil_, d1njin_, d1njio_, d1njip_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiu_, d1njiv_, d1njiw_, d1njix_, d1njiy_, d1njiz_
   complexed with cd, cl, clm, k, mg, na; mutant

Details for d1njim_

PDB Entry: 1nji, 3 Å

PDB Description: Structure of chloramphenicol bound to the 50S ribosomal subunit

PDB Compounds: (M:) 50S ribosomal protein L15P

SCOP Domain Sequences for d1njim_:

Sequence, based on SEQRES records:

>d1njim_ c.12.1.1 (M:) Ribosomal protein L15 (L15p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrheltl
iaddfsegarekvegaggsveltdlgeerq

Sequence, based on observed residues (ATOM records):

>d1njim_ c.12.1.1 (M:) Ribosomal protein L15 (L15p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaefrvdvrdvveeaddadyvkvlgagqvrheltliaddf
segarekvegaggsveltdlgeerq

Timeline for d1njim_:

• d1njim_ first appeared in SCOP 1.65
  
• d1njim_ appears in SCOP 1.71
  
• d1njim_ appears in SCOP 1.75
  
• d1njim_ appears in the current release, SCOPe 2.08