Lineage for d1njil_ (1nji L:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296781Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 296782Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
  5. 296783Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 296784Protein Ribosomal protein L14 [50195] (2 species)
  7. 296785Species Archaeon Haloarcula marismortui [TaxId:2238] [50197] (12 PDB entries)
  8. 296789Domain d1njil_: 1nji L: [85803]
    Other proteins in same PDB: d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njic1, d1njic2, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njij_, d1njik_, d1njim_, d1njin_, d1njio_, d1njip_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiu_, d1njiv_, d1njiw_, d1njix_, d1njiy_, d1njiz_
    complexed with cd, cl, clm, k, mg, na; mutant

Details for d1njil_

PDB Entry: 1nji (more details), 3 Å

PDB Description: Structure of chloramphenicol bound to the 50S ribosomal subunit

SCOP Domain Sequences for d1njil_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1njil_ b.39.1.1 (L:) Ribosomal protein L14 {Archaeon Haloarcula marismortui}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

SCOP Domain Coordinates for d1njil_:

Click to download the PDB-style file with coordinates for d1njil_.
(The format of our PDB-style files is described here.)

Timeline for d1njil_: