Lineage for d1njii_ (1nji I:)

  1. Root: SCOP 1.65
  2. 347435Class j: Peptides [58231] (105 folds)
  3. 348615Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 348616Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 348617Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 348618Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 348619Species Archaeon Haloarcula marismortui [TaxId:2238] [64662] (11 PDB entries)
  8. 348623Domain d1njii_: 1nji I: [85800]
    Other proteins in same PDB: d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njic1, d1njic2, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njij_, d1njik_, d1njil_, d1njim_, d1njin_, d1njio_, d1njip_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiu_, d1njiv_, d1njiw_, d1njix_, d1njiy_, d1njiz_
    complexed with cd, cl, clm, k, mg, na; mutant

Details for d1njii_

PDB Entry: 1nji (more details), 3 Å

PDB Description: Structure of chloramphenicol bound to the 50S ribosomal subunit

SCOP Domain Sequences for d1njii_:

Sequence, based on SEQRES records: (download)

>d1njii_ j.84.1.1 (I:) Ribosomal protein L10 {Archaeon Haloarcula marismortui}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d1njii_ j.84.1.1 (I:) Ribosomal protein L10 {Archaeon Haloarcula marismortui}
ipewkqeevdaivemiesrntlleraldd

SCOP Domain Coordinates for d1njii_:

Click to download the PDB-style file with coordinates for d1njii_.
(The format of our PDB-style files is described here.)

Timeline for d1njii_: