Lineage for d1njid_ (1nji D:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1126671Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1126691Superfamily b.43.3: Translation proteins [50447] (6 families) (S)
  5. 1126852Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein)
  6. 1126853Protein Ribosomal protein L3 [50462] (4 species)
    superfamily fold is elaborated with additional structures
  7. 1126894Species Haloarcula marismortui [TaxId:2238] [50463] (58 PDB entries)
    Uniprot P20279
  8. 1126932Domain d1njid_: 1nji D: [85794]
    Other proteins in same PDB: d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njic1, d1njic2, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njij_, d1njik_, d1njil_, d1njim_, d1njin_, d1njio_, d1njip_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiu_, d1njiv_, d1njiw_, d1njix_, d1njiy_, d1njiz_
    complexed with cd, cl, clm, k, mg, na

Details for d1njid_

PDB Entry: 1nji (more details), 3 Å

PDB Description: Structure of chloramphenicol bound to the 50S ribosomal subunit
PDB Compounds: (D:) 50S ribosomal protein L3P

SCOPe Domain Sequences for d1njid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1njid_ b.43.3.2 (D:) Ribosomal protein L3 {Haloarcula marismortui [TaxId: 2238]}
pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns
pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd
pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald
ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg
pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs
vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg

SCOPe Domain Coordinates for d1njid_:

Click to download the PDB-style file with coordinates for d1njid_.
(The format of our PDB-style files is described here.)

Timeline for d1njid_: