SCOPe 2.06: Domain d1njic2: 1nji C:1-90

Lineage for d1njic2 (1nji C:1-90)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
   incomplete OB-fold lacking the last strand

7. Species Haloarcula marismortui [TaxId:2238] [50301] (40 PDB entries)
   Uniprot P20276
   includes the N-terminal tail

8. Domain d1njic2: 1nji C:1-90 [85793]
   Other proteins in same PDB: d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njic1, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njij_, d1njik_, d1njil_, d1njim_, d1njin_, d1njio_, d1njip_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiu_, d1njiv_, d1njiw_, d1njix_, d1njiy_, d1njiz_
   complexed with cd, cl, clm, k, mg, na

Details for d1njic2

PDB Entry: 1nji, 3 Å

PDB Description: Structure of chloramphenicol bound to the 50S ribosomal subunit

PDB Compounds: (C:) 50S ribosomal protein L2P

SCOPe Domain Sequences for d1njic2:

Sequence; same for both SEQRES and ATOM records:

>d1njic2 b.40.4.5 (C:1-90) N-terminal domain of ribosomal protein L2 {Haloarcula marismortui [TaxId: 2238]}
grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
edgdrrlilapegvgvgdelqvgvdaeiap

Timeline for d1njic2:

• d1njic2 first appeared in SCOP 1.65
  
• d1njic2 appears in SCOPe 2.05
  
• d1njic2 appears in SCOPe 2.07
  
• d1njic2 appears in the current release, SCOPe 2.08