Lineage for d1njic1 (1nji C:91-237)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 461193Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 461603Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families) (S)
    many known members contain KOW motif
  5. 461667Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 461668Protein C-terminal domain of ribosomal protein L2 [50115] (2 species)
  7. 461669Species Archaeon Haloarcula marismortui [TaxId:2238] [50117] (19 PDB entries)
  8. 461673Domain d1njic1: 1nji C:91-237 [85792]
    Other proteins in same PDB: d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njic2, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njij_, d1njik_, d1njil_, d1njim_, d1njin_, d1njio_, d1njip_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiu_, d1njiv_, d1njiw_, d1njix_, d1njiy_, d1njiz_

Details for d1njic1

PDB Entry: 1nji (more details), 3 Å

PDB Description: Structure of chloramphenicol bound to the 50S ribosomal subunit
PDB Compounds: (C:)

SCOP Domain Sequences for d1njic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1njic1 b.34.5.3 (C:91-237) C-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui}
gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp
qcratigvvggggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg
kpksisrnappgrkvgdiaskrtgrgg

SCOP Domain Coordinates for d1njic1:

Click to download the PDB-style file with coordinates for d1njic1.
(The format of our PDB-style files is described here.)

Timeline for d1njic1: