Lineage for d1njic1 (1nji C:91-237)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 372425Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 372810Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families) (S)
    many known members contain KOW motif
  5. 372866Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 372867Protein C-terminal domain of ribosomal protein L2 [50115] (2 species)
  7. 372868Species Archaeon Haloarcula marismortui [TaxId:2238] [50117] (18 PDB entries)
  8. 372871Domain d1njic1: 1nji C:91-237 [85792]
    Other proteins in same PDB: d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njic2, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njij_, d1njik_, d1njil_, d1njim_, d1njin_, d1njio_, d1njip_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiu_, d1njiv_, d1njiw_, d1njix_, d1njiy_, d1njiz_
    complexed with cd, cl, clm, k, mg, na; mutant

Details for d1njic1

PDB Entry: 1nji (more details), 3 Å

PDB Description: Structure of chloramphenicol bound to the 50S ribosomal subunit

SCOP Domain Sequences for d1njic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1njic1 b.34.5.3 (C:91-237) C-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui}
gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp
qcratigvvggggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg
kpksisrnappgrkvgdiaskrtgrgg

SCOP Domain Coordinates for d1njic1:

Click to download the PDB-style file with coordinates for d1njic1.
(The format of our PDB-style files is described here.)

Timeline for d1njic1: