Class b: All beta proteins [48724] (126 folds) |
Fold b.34: SH3-like barrel [50036] (13 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families) many known members contain KOW motif |
Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein) |
Protein C-terminal domain of ribosomal protein L2 [50115] (2 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [50117] (12 PDB entries) |
Domain d1njic1: 1nji C:91-237 [85792] Other proteins in same PDB: d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njic2, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njij_, d1njik_, d1njil_, d1njim_, d1njin_, d1njio_, d1njip_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiu_, d1njiv_, d1njiw_, d1njix_, d1njiy_, d1njiz_ complexed with cd, cl, clm, k, mg, na; mutant |
PDB Entry: 1nji (more details), 3 Å
SCOP Domain Sequences for d1njic1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1njic1 b.34.5.3 (C:91-237) C-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui} gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp qcratigvvggggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg kpksisrnappgrkvgdiaskrtgrgg
Timeline for d1njic1:
View in 3D Domains from other chains: (mouse over for more information) d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njij_, d1njik_, d1njil_, d1njim_, d1njin_, d1njio_, d1njip_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiu_, d1njiv_, d1njiw_, d1njix_, d1njiy_, d1njiz_ |