SCOP 1.73: Domain d1nji2_: 1nji 2:

Lineage for d1nji2_ (1nji 2:)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (6 families)

5. Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein)

6. Protein Ribosomal protein L37e [57834] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [57835] (40 PDB entries)

8. Domain d1nji2_: 1nji 2: [85789]
   Other proteins in same PDB: d1nji1_, d1nji3_, d1nji4_, d1njic1, d1njic2, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njij_, d1njik_, d1njil_, d1njim_, d1njin_, d1njio_, d1njip_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiu_, d1njiv_, d1njiw_, d1njix_, d1njiy_, d1njiz_
   complexed with cd, cl, clm, k, mg, na; mutant

Details for d1nji2_

PDB Entry: 1nji, 3 Å

PDB Description: Structure of chloramphenicol bound to the 50S ribosomal subunit

PDB Compounds: (2:) 50S ribosomal protein L37e

SCOP Domain Sequences for d1nji2_:

Sequence; same for both SEQRES and ATOM records:

>d1nji2_ g.41.8.2 (2:) Ribosomal protein L37e {Archaeon Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

Timeline for d1nji2_:

• d1nji2_ first appeared in SCOP 1.65
  
• d1nji2_ appears in SCOP 1.71
  
• d1nji2_ appears in SCOP 1.75
  
• d1nji2_ appears in the current release, SCOPe 2.08