Lineage for d1nji1_ (1nji 1:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 624613Fold g.41: Rubredoxin-like [57769] (14 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 624941Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (4 families) (S)
  5. 624942Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
  6. 624943Protein Ribosomal protein L37ae [57831] (1 species)
  7. 624944Species Archaeon Haloarcula marismortui [TaxId:2238] [57832] (19 PDB entries)
  8. 624948Domain d1nji1_: 1nji 1: [85788]
    Other proteins in same PDB: d1nji2_, d1nji3_, d1nji4_, d1njic1, d1njic2, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njij_, d1njik_, d1njil_, d1njim_, d1njin_, d1njio_, d1njip_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiu_, d1njiv_, d1njiw_, d1njix_, d1njiy_, d1njiz_
    complexed with cd, cl, clm, k, mg, na; mutant

Details for d1nji1_

PDB Entry: 1nji (more details), 3 Å

PDB Description: Structure of chloramphenicol bound to the 50S ribosomal subunit
PDB Compounds: (1:)

SCOP Domain Sequences for d1nji1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nji1_ g.41.8.1 (1:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui}
rtgrfgpryglkirvrvadveikhkkkhkcpvcgfkklkragtgiwmcghcgykiaggcy
qpetvagkavmka

SCOP Domain Coordinates for d1nji1_:

Click to download the PDB-style file with coordinates for d1nji1_.
(The format of our PDB-style files is described here.)

Timeline for d1nji1_: