Lineage for d1njfd_ (1njf D:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 394970Family c.37.1.20: Extended AAA-ATPase domain [81269] (18 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 395009Protein delta prime subunit of DNA polymerase III, N-domain [52711] (1 species)
    contains additional alpha-helical domain after the family specific domains
  7. 395010Species Escherichia coli [TaxId:562] [52712] (4 PDB entries)
  8. 395015Domain d1njfd_: 1njf D: [85784]
    AAA+ domain only; nucleotide-bound form
    complexed with adp, atg, zn

Details for d1njfd_

PDB Entry: 1njf (more details), 2.3 Å

PDB Description: Nucleotide bound form of an isolated E. coli clamp loader gamma subunit

SCOP Domain Sequences for d1njfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1njfd_ c.37.1.20 (D:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli}
vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc
etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl
idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir
hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlgt

SCOP Domain Coordinates for d1njfd_:

Click to download the PDB-style file with coordinates for d1njfd_.
(The format of our PDB-style files is described here.)

Timeline for d1njfd_: