Lineage for d1njfc_ (1njf C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849193Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 1849272Protein delta prime subunit of DNA polymerase III, N-domain [52711] (1 species)
    contains additional alpha-helical domain after the family specific domains
  7. 1849273Species Escherichia coli [TaxId:562] [52712] (6 PDB entries)
    Uniprot P28631
  8. 1849277Domain d1njfc_: 1njf C: [85783]
    AAA+ domain only; nucleotide-bound form
    complexed with adp, ags, zn

Details for d1njfc_

PDB Entry: 1njf (more details), 2.3 Å

PDB Description: Nucleotide bound form of an isolated E. coli clamp loader gamma subunit
PDB Compounds: (C:) DNA polymerase III subunit gamma

SCOPe Domain Sequences for d1njfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1njfc_ c.37.1.20 (C:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}
vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc
etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl
idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir
hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlgt

SCOPe Domain Coordinates for d1njfc_:

Click to download the PDB-style file with coordinates for d1njfc_.
(The format of our PDB-style files is described here.)

Timeline for d1njfc_: