SCOP 1.69: Domain d1njfb_: 1njf B:

Lineage for d1njfb_ (1njf B:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (25 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein delta prime subunit of DNA polymerase III, N-domain [52711] (1 species)
   contains additional alpha-helical domain after the family specific domains

7. Species Escherichia coli [TaxId:562] [52712] (4 PDB entries)

8. Domain d1njfb_: 1njf B: [85782]

Details for d1njfb_

PDB Entry: 1njf, 2.3 Å

PDB Description: Nucleotide bound form of an isolated E. coli clamp loader gamma subunit

SCOP Domain Sequences for d1njfb_:

Sequence; same for both SEQRES and ATOM records:

>d1njfb_ c.37.1.20 (B:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli}
vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc
etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl
idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir
hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlgt

Timeline for d1njfb_:

• d1njfb_ first appeared in SCOP 1.65
  
• d1njfb_ appears in SCOP 1.67
  
• d1njfb_ appears in SCOP 1.71
  
• d1njfb_ appears in the current release, SCOPe 2.08