Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein delta prime subunit of DNA polymerase III, N-domain [52711] (1 species) contains additional alpha-helical domain after the family specific domains |
Species Escherichia coli [TaxId:562] [52712] (6 PDB entries) Uniprot P28631 |
Domain d1njfa_: 1njf A: [85781] AAA+ domain only; nucleotide-bound form complexed with adp, atg, zn |
PDB Entry: 1njf (more details), 2.3 Å
SCOPe Domain Sequences for d1njfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlgt
Timeline for d1njfa_: