| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) ![]() |
| Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins) |
| Protein Prolyl-tRNA synthetase (ProRS) domain [64071] (3 species) |
| Species Arhaeon (Methanocaldococcus janaschii) [89715] (1 PDB entry) |
| Domain d1nj8d1: 1nj8 D:268-393 [85778] Other proteins in same PDB: d1nj8a2, d1nj8a3, d1nj8b2, d1nj8b3, d1nj8c2, d1nj8c3, d1nj8d2, d1nj8d3 |
PDB Entry: 1nj8 (more details), 3.2 Å
SCOP Domain Sequences for d1nj8d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nj8d1 c.51.1.1 (D:268-393) Prolyl-tRNA synthetase (ProRS) domain {Arhaeon (Methanocaldococcus janaschii)}
kglilppivapiqvvivplifkgkedivmekakeiyeklkgkfrvhiddrdirpgrkfnd
weikgvplrievgpkdienkkitlfrrdtmekfqvdetqlmevvektlnnimeniknraw
ekfenf
Timeline for d1nj8d1: