Lineage for d1nj8b3 (1nj8 B:0-267)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730671Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 730672Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (3 families) (S)
  5. 730673Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (15 proteins)
  6. 730810Protein Prolyl-tRNA synthetase (ProRS) [64347] (3 species)
  7. 730811Species Archaeon (Methanocaldococcus jannaschii) [TaxId:2190] [90010] (1 PDB entry)
  8. 730813Domain d1nj8b3: 1nj8 B:0-267 [85774]
    Other proteins in same PDB: d1nj8a1, d1nj8a2, d1nj8b1, d1nj8b2, d1nj8c1, d1nj8c2, d1nj8d1, d1nj8d2

Details for d1nj8b3

PDB Entry: 1nj8 (more details), 3.2 Å

PDB Description: Crystal Structure of Prolyl-tRNA Synthetase from Methanocaldococcus janaschii
PDB Compounds: (B:) Proline-tRNA Synthetase

SCOP Domain Sequences for d1nj8b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nj8b3 d.104.1.1 (B:0-267) Prolyl-tRNA synthetase (ProRS) {Archaeon (Methanocaldococcus jannaschii) [TaxId: 2190]}
mlefsewysdilekaeiydvrypikgcgvylpygfkirrytfeiirnlldesghdealfp
mlipedllakeaehikgfedevywvthggktqldvklalrptsetpiyymmklwvkvhtd
lpikiyqivntfryetkhtrplirlreimtfkeahtahstkeeaenqvkeaisiykkffd
tlgipyliskrpewdkfpgaeytmafdtifpdgrtmqiatvhnlgqnfsktfeiifetpt
gdkdyayqtcygisdrviasiiaihgde

SCOP Domain Coordinates for d1nj8b3:

Click to download the PDB-style file with coordinates for d1nj8b3.
(The format of our PDB-style files is described here.)

Timeline for d1nj8b3: