Lineage for d1nj8a3 (1nj8 A:0-267)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1214435Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1214436Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families) (S)
  5. 1214437Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 1214578Protein Prolyl-tRNA synthetase (ProRS) [64347] (3 species)
  7. 1214579Species Methanocaldococcus jannaschii [TaxId:2190] [90010] (1 PDB entry)
  8. 1214580Domain d1nj8a3: 1nj8 A:0-267 [85771]
    Other proteins in same PDB: d1nj8a1, d1nj8a2, d1nj8b1, d1nj8b2, d1nj8c1, d1nj8c2, d1nj8d1, d1nj8d2

Details for d1nj8a3

PDB Entry: 1nj8 (more details), 3.2 Å

PDB Description: Crystal Structure of Prolyl-tRNA Synthetase from Methanocaldococcus janaschii
PDB Compounds: (A:) Proline-tRNA Synthetase

SCOPe Domain Sequences for d1nj8a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nj8a3 d.104.1.1 (A:0-267) Prolyl-tRNA synthetase (ProRS) {Methanocaldococcus jannaschii [TaxId: 2190]}
mlefsewysdilekaeiydvrypikgcgvylpygfkirrytfeiirnlldesghdealfp
mlipedllakeaehikgfedevywvthggktqldvklalrptsetpiyymmklwvkvhtd
lpikiyqivntfryetkhtrplirlreimtfkeahtahstkeeaenqvkeaisiykkffd
tlgipyliskrpewdkfpgaeytmafdtifpdgrtmqiatvhnlgqnfsktfeiifetpt
gdkdyayqtcygisdrviasiiaihgde

SCOPe Domain Coordinates for d1nj8a3:

Click to download the PDB-style file with coordinates for d1nj8a3.
(The format of our PDB-style files is described here.)

Timeline for d1nj8a3: