SCOPe 2.05: Domain d1nj6a1: 1nj6 A:284-410

Lineage for d1nj6a1 (1nj6 A:284-410)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)

6. Protein Prolyl-tRNA synthetase (ProRS) domain [64071] (3 species)

7. Species Methanothermobacter thermautotrophicus [TaxId:145262] [89714] (4 PDB entries)

8. Domain d1nj6a1: 1nj6 A:284-410 [85765]
   Other proteins in same PDB: d1nj6a2, d1nj6a3
   protein/RNA complex; complexed with a5a, mg, zn

Details for d1nj6a1

PDB Entry: 1nj6, 2.85 Å

PDB Description: Crystal structure of Prolyl-tRNA Synthetase from Methanothermobacter thermautotrophicus bound to alanine sulfamoyl adenylate

PDB Compounds: (A:) Proline-tRNA Synthetase

SCOPe Domain Sequences for d1nj6a1:

Sequence; same for both SEQRES and ATOM records:

>d1nj6a1 c.51.1.1 (A:284-410) Prolyl-tRNA synthetase (ProRS) domain {Methanothermobacter thermautotrophicus [TaxId: 145262]}
sglclppdvaahqvvivpiifkkaaeevmeacrelrsrleaagfrvhlddrdiragrkyy
ewemrgvplrveigprdlekgaavisrrdtgekvtadlqgieetlrelmkdilenlrtra
wermese

Timeline for d1nj6a1:

• d1nj6a1 first appeared in SCOP 1.65
  
• d1nj6a1 appears in SCOPe 2.04
  
• d1nj6a1 appears in SCOPe 2.06
  
• d1nj6a1 appears in the current release, SCOPe 2.08