|  | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) | 
|  | Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest | 
|  | Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family)  | 
|  | Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins) | 
|  | Protein Prolyl-tRNA synthetase (ProRS) domain [64071] (3 species) | 
|  | Species Arhaeon (Methanothermobacter thermautotrophicus) [TaxId:145262] [89714] (4 PDB entries) | 
|  | Domain d1nj6a1: 1nj6 A:284-410 [85765] Other proteins in same PDB: d1nj6a2, d1nj6a3 complexed with a5a, mg, zn | 
PDB Entry: 1nj6 (more details), 2.85 Å
SCOP Domain Sequences for d1nj6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nj6a1 c.51.1.1 (A:284-410) Prolyl-tRNA synthetase (ProRS) domain {Arhaeon (Methanothermobacter thermautotrophicus)}
sglclppdvaahqvvivpiifkkaaeevmeacrelrsrleaagfrvhlddrdiragrkyy
ewemrgvplrveigprdlekgaavisrrdtgekvtadlqgieetlrelmkdilenlrtra
wermese
Timeline for d1nj6a1: