Lineage for d1nj6a1 (1nj6 A:284-410)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 396855Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 396856Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) (S)
  5. 396857Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins)
  6. 396893Protein Prolyl-tRNA synthetase (ProRS) domain [64071] (3 species)
  7. 396899Species Arhaeon (Methanothermobacter thermautotrophicus) [TaxId:145262] [89714] (4 PDB entries)
  8. 396902Domain d1nj6a1: 1nj6 A:284-410 [85765]
    Other proteins in same PDB: d1nj6a2, d1nj6a3
    complexed with a5a, mg, zn

Details for d1nj6a1

PDB Entry: 1nj6 (more details), 2.85 Å

PDB Description: Crystal structure of Prolyl-tRNA Synthetase from Methanothermobacter thermautotrophicus bound to alanine sulfamoyl adenylate

SCOP Domain Sequences for d1nj6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nj6a1 c.51.1.1 (A:284-410) Prolyl-tRNA synthetase (ProRS) domain {Arhaeon (Methanothermobacter thermautotrophicus)}
sglclppdvaahqvvivpiifkkaaeevmeacrelrsrleaagfrvhlddrdiragrkyy
ewemrgvplrveigprdlekgaavisrrdtgekvtadlqgieetlrelmkdilenlrtra
wermese

SCOP Domain Coordinates for d1nj6a1:

Click to download the PDB-style file with coordinates for d1nj6a1.
(The format of our PDB-style files is described here.)

Timeline for d1nj6a1: