| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) ![]() |
| Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins) |
| Protein Prolyl-tRNA synthetase (ProRS) domain [64071] (3 species) |
| Species Arhaeon (Methanothermobacter thermautotrophicus) [TaxId:145262] [89714] (4 PDB entries) |
| Domain d1nj2a1: 1nj2 A:284-410 [85758] Other proteins in same PDB: d1nj2a2, d1nj2a3 |
PDB Entry: 1nj2 (more details), 3.11 Å
SCOP Domain Sequences for d1nj2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nj2a1 c.51.1.1 (A:284-410) Prolyl-tRNA synthetase (ProRS) domain {Arhaeon (Methanothermobacter thermautotrophicus)}
sglclppdvaahqvvivpiifkkaaeevmeacrelrsrleaagfrvhlddrdiragrkyy
ewemrgvplrveigprdlekgaavisrrdtgekvtadlqgieetlrelmkdilenlrtra
wermese
Timeline for d1nj2a1: