SCOP 1.73: Domain d1nj1a1: 1nj1 A:284-410

Lineage for d1nj1a1 (1nj1 A:284-410)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (5 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Class II aaRS ABD-related [52954] (2 families)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)

6. Protein Prolyl-tRNA synthetase (ProRS) domain [64071] (3 species)

7. Species Arhaeon (Methanothermobacter thermautotrophicus) [TaxId:145262] [89714] (4 PDB entries)

8. Domain d1nj1a1: 1nj1 A:284-410 [85755]
   Other proteins in same PDB: d1nj1a2, d1nj1a3
   complexed with 5ca, mg, zn

Details for d1nj1a1

PDB Entry: 1nj1, 2.55 Å

PDB Description: Crystal structure of Prolyl-tRNA Synthetase from Methanothermobacter thermautotrophicus bound to cysteine sulfamoyl adenylate

PDB Compounds: (A:) Proline-tRNA Synthetase

SCOP Domain Sequences for d1nj1a1:

Sequence; same for both SEQRES and ATOM records:

>d1nj1a1 c.51.1.1 (A:284-410) Prolyl-tRNA synthetase (ProRS) domain {Arhaeon (Methanothermobacter thermautotrophicus) [TaxId: 145262]}
sglclppdvaahqvvivpiifkkaaeevmeacrelrsrleaagfrvhlddrdiragrkyy
ewemrgvplrveigprdlekgaavisrrdtgekvtadlqgieetlrelmkdilenlrtra
wermese

Timeline for d1nj1a1:

• d1nj1a1 first appeared in SCOP 1.65
  
• d1nj1a1 appears in SCOP 1.71
  
• d1nj1a1 appears in SCOP 1.75
  
• d1nj1a1 appears in the current release, SCOPe 2.08