SCOP 1.75: Domain d1nikj_: 1nik J:

Lineage for d1nikj_ (1nik J:)

1. Root: SCOP 1.75

2. Class i: Low resolution protein structures [58117] (26 folds)

3. Fold i.8: RNA polymerase [58180] (1 superfamily)

4. Superfamily i.8.1: RNA polymerase [58181] (1 family)

5. Family i.8.1.1: RNA polymerase [58182] (2 proteins)

6. Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries)

8. Domain d1nikj_: 1nik J: [85752]

Details for d1nikj_

PDB Entry: 1nik, 4.1 Å

PDB Description: wild type rna polymerase ii

PDB Compounds: (J:) DNA-directed RNA polymerase II, chain RPB10

SCOP Domain Sequences for d1nikj_:

Sequence; same for both SEQRES and ATOM records:

>d1nikj_ i.8.1.1 (J:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

Timeline for d1nikj_:

• d1nikj_ first appeared in SCOP 1.65
  
• d1nikj_ appears in SCOP 1.73
  
• d1nikj_ appears in SCOPe 2.01
  
• d1nikj_ appears in the current release, SCOPe 2.08