SCOP 1.73: Domain d1nija2: 1nij A:224-318

Lineage for d1nija2 (1nij A:224-318)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.237: Hypothetical protein YjiA, C-terminal domain [90001] (1 superfamily)
   beta-alpha-beta(4)-alpha; 2 layers: a/b; antiparallel sheet 15234; topological similarity to the HPr-like fold

4. Superfamily d.237.1: Hypothetical protein YjiA, C-terminal domain [90002] (1 family)

5. Family d.237.1.1: Hypothetical protein YjiA, C-terminal domain [90003] (1 protein)

6. Protein Hypothetical protein YjiA, C-terminal domain [90004] (1 species)
   homologue of the cobalamin biosynthesis protein CobW

7. Species Escherichia coli [TaxId:562] [90005] (1 PDB entry)

8. Domain d1nija2: 1nij A:224-318 [85742]
   Other proteins in same PDB: d1nija1
   CASP5
   structural genomics

Details for d1nija2

PDB Entry: 1nij, 2 Å

PDB Description: yjia protein

PDB Compounds: (A:) Hypothetical protein yjiA

SCOP Domain Sequences for d1nija2:

Sequence; same for both SEQRES and ATOM records:

>d1nija2 d.237.1.1 (A:224-318) Hypothetical protein YjiA, C-terminal domain {Escherichia coli [TaxId: 562]}
issivveldypvdisevsrvmenlllesadkllrykgmlwidgepnrllfqgvqrlysad
wdrpwgdekphstmvfigiqlpeeeiraafaglrk

Timeline for d1nija2:

• d1nija2 first appeared in SCOP 1.65
  
• d1nija2 appears in SCOP 1.71
  
• d1nija2 appears in SCOP 1.75
  
• d1nija2 appears in the current release, SCOPe 2.08