Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.10: Nitrogenase iron protein-like [52652] (13 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
Protein Hypothetical protein YjiA, N-terminal domain [89671] (1 species) homologue of the cobalamin biosynthesis protein CobW |
Species Escherichia coli [TaxId:562] [89672] (1 PDB entry) |
Domain d1nija1: 1nij A:2-223 [85741] Other proteins in same PDB: d1nija2 CASP5 structural genomics |
PDB Entry: 1nij (more details), 2 Å
SCOP Domain Sequences for d1nija1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} npiavtlltgflgagkttllrhilneqhgykiavienefgevsvddqligdratqiktlt ngciccsrsneledalldlldnldkgniqfdrlviectgmadpgpiiqtffshevlcqry lldgvialvdavhadeqmnqftiaqsqvgyadrilltktdvageaeklherlarinarap vytvthgdidlgllfntngfmleenvvstkprfhfiadkqnd
Timeline for d1nija1: