Lineage for d1nija1 (1nij A:2-223)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 696576Family c.37.1.10: Nitrogenase iron protein-like [52652] (13 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 696753Protein Hypothetical protein YjiA, N-terminal domain [89671] (1 species)
    homologue of the cobalamin biosynthesis protein CobW
  7. 696754Species Escherichia coli [TaxId:562] [89672] (1 PDB entry)
  8. 696755Domain d1nija1: 1nij A:2-223 [85741]
    Other proteins in same PDB: d1nija2
    CASP5
    structural genomics

Details for d1nija1

PDB Entry: 1nij (more details), 2 Å

PDB Description: yjia protein
PDB Compounds: (A:) Hypothetical protein yjiA

SCOP Domain Sequences for d1nija1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]}
npiavtlltgflgagkttllrhilneqhgykiavienefgevsvddqligdratqiktlt
ngciccsrsneledalldlldnldkgniqfdrlviectgmadpgpiiqtffshevlcqry
lldgvialvdavhadeqmnqftiaqsqvgyadrilltktdvageaeklherlarinarap
vytvthgdidlgllfntngfmleenvvstkprfhfiadkqnd

SCOP Domain Coordinates for d1nija1:

Click to download the PDB-style file with coordinates for d1nija1.
(The format of our PDB-style files is described here.)

Timeline for d1nija1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nija2