SCOPe 2.08: Domain d1ni7a1: 1ni7 A:1-147

Lineage for d1ni7a1 (1ni7 A:1-147)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.224: SufE/NifU [82648] (1 superfamily)
   alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123

4. Superfamily d.224.1: SufE/NifU [82649] (4 families)
   iron-sulfur cluster assembly proteins

5. Family d.224.1.1: SufE-like [82650] (3 proteins)
   Fe-S metabolism associated domain
   automatically mapped to Pfam PF02657

6. Protein Hypothetical protein YgdK [89912] (1 species)

7. Species Escherichia coli [TaxId:562] [89913] (1 PDB entry)

8. Domain d1ni7a1: 1ni7 A:1-147 [85738]
   Other proteins in same PDB: d1ni7a2
   structural genomics; NESG target ER75

Details for d1ni7a1

PDB Entry: 1ni7

PDB Description: northeast structural genomic consortium target er75

PDB Compounds: (A:) Hypothetical protein ygdK

SCOPe Domain Sequences for d1ni7a1:

Sequence; same for both SEQRES and ATOM records:

>d1ni7a1 d.224.1.1 (A:1-147) Hypothetical protein YgdK {Escherichia coli [TaxId: 562]}
mtnpqfaghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiag
cenrvwlgytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelg
lraqlsasrsqglnalseaiiaatkqv

Timeline for d1ni7a1:

• d1ni7a1 first appeared in SCOP 1.65, called d1ni7a_
  
• d1ni7a1 appears in SCOPe 2.07