Lineage for d1ni6b_ (1ni6 B:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 648983Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 648984Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 648985Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (3 proteins)
  6. 649019Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. 649020Species Human (Homo sapiens) [TaxId:9606] [48616] (19 PDB entries)
  8. 649038Domain d1ni6b_: 1ni6 B: [85735]

Details for d1ni6b_

PDB Entry: 1ni6 (more details), 2.1 Å

PDB Description: comparisions of the heme-free and-bound crystal structures of human heme oxygenase-1
PDB Compounds: (B:) Heme oxygenase 1

SCOP Domain Sequences for d1ni6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ni6b_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

SCOP Domain Coordinates for d1ni6b_:

Click to download the PDB-style file with coordinates for d1ni6b_.
(The format of our PDB-style files is described here.)

Timeline for d1ni6b_: