SCOPe 2.06: Domain d1ni6a_: 1ni6 A:

Lineage for d1ni6a_ (1ni6 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
   automatically mapped to Pfam PF01126

6. Protein Heme oxygenase-1 (HO-1) [48615] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48616] (25 PDB entries)
   Uniprot P09601

8. Domain d1ni6a_: 1ni6 A: [85734]
   heme-free structure
   complexed with cl, tre

Details for d1ni6a_

PDB Entry: 1ni6, 2.1 Å

PDB Description: comparisions of the heme-free and-bound crystal structures of human heme oxygenase-1

PDB Compounds: (A:) Heme oxygenase 1

SCOPe Domain Sequences for d1ni6a_:

Sequence; same for both SEQRES and ATOM records:

>d1ni6a_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellthd

Timeline for d1ni6a_:

• d1ni6a_ first appeared in SCOP 1.65
  
• d1ni6a_ appears in SCOPe 2.05
  
• d1ni6a_ appears in SCOPe 2.07
  
• d1ni6a_ appears in the current release, SCOPe 2.08