Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) |
Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (4 proteins) |
Protein E1-beta subunit of pyruvate dehydrogenase, C-domain [69521] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [89713] (2 PDB entries) |
Domain d1ni4d2: 1ni4 D:192-329 [85733] Other proteins in same PDB: d1ni4a_, d1ni4b1, d1ni4c_, d1ni4d1 complexed with k, mg, mse, tpp; mutant |
PDB Entry: 1ni4 (more details), 1.95 Å
SCOP Domain Sequences for d1ni4d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ni4d2 c.48.1.2 (D:192-329) E1-beta subunit of pyruvate dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]} lipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrtirpmdmetiea svmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadvpmpyakiledn sipqvkdiifaikktlni
Timeline for d1ni4d2:
View in 3D Domains from other chains: (mouse over for more information) d1ni4a_, d1ni4b1, d1ni4b2, d1ni4c_ |